-
1 волшебное слово
incantation slРусско-английский словарь по вычислительной технике и программированию > волшебное слово
-
2 магическая формула
incantation имя существительное:Русско-английский синонимический словарь > магическая формула
-
3 заклинание
1) General subject: abracadabra, abraxas, adjuration, conjuration, exorcism, incantation, invocation, juju, medicine, obsecration, obtestation, pater, paternoster, pishogue, spell2) Religion: charm, incantation (A use of spells or verbal charms spoken or sung as a part of a ritual of magic; also a written or recited formula of words designed to produce a particular effect), spell (A spoken word or form of words held to have magic power)3) Indian language: mantra -
4 колдовство
1) General subject: Mumbo Jumbo, arcane rites (и т. п.), bewitchment, conjuration, diablerie, diabolism, enchantment, fascination, hoodoo, incantation, invocation, magic, malefice, medicine, necromancy, obeah, sorcery, sortilege, voodoo, voodooism, witchcraft, witchery, wizardry, zombi, zombie, spellcraft2) French: diablery4) Religion: Mumbo Jumbo (A complicated often ritualistic observance with elaborate trappings), bewitchery, black magic, conjury, devilry, diabolism ( Dealings with the devil), hoodoo (A body of practices of sympathetic magic traditional among blacks in the southern U.S.), incantation (A use of spells or verbal charms spoken or sung as a part of a ritual of magic; also a written or recited formula of words designed to produce a particular effect), magic (Magic rites or incantations), obi, voodooism (The practice of witchcraft)5) Irish: pishogue7) Makarov: arcane knowledge, arcane rites (и т.п.) -
5 магическая формула
1) General subject: abracadabra, exorcism (для изгнания беса), incantation, magic spell, pater, paternoster2) Religion: charm, incantation (A use of spells or verbal charms spoken or sung as a part of a ritual of magic; also a written or recited formula of words designed to produce a particular effect)Универсальный русско-английский словарь > магическая формула
-
6 чары
1) General subject: bewitchment, cantrip, charms (обыкнов. pl), enticement, fascination, glamor, glamour, incantation, invocation, juju, magic, necromancies, necromancy, sorceries, sorcery, spell, witchcraft, witcheries, witchery, wizardry (тж. перен.), enchantment2) Religion: bewitchery, incantation (A use of spells or verbal charms spoken or sung as a part of a ritual of magic; also a written or recited formula of words designed to produce a particular effect), obeah, obi3) Scottish language: cantraip -
7 заклинание
conjuration* * ** * *conjuration, incantation, spell; exorcism* * *abracadabraadjurationconjurationexorcismincantationinvocationju-juobtestationspell -
8 наговор
1) (клевета)
slander
2) (заклинание)
incantation* * ** * *1) slander, calumny 2) incantation* * *defamationobloquy -
9 заклинание
(особый вид молитвенных формул в ритуале, имеющих целью изгнание из больного болезни или диавола-беса) exorcism by incantation, invocation; ( слово) spell, ( магическое слово) abrasax, abraxas -
10 амулет
1) General subject: abraxas, amulet, charm, churinga, fetish, joss, juju, medicine, periapt, phylactery, scarab, scarabaeus, voodoo, fetiche2) Religion: amulet (A charm - as an ornament - often inscribed with a magic incantation or symbol to protect the wearer against evil - as disease or witchcraft - or to aid him), charm-seal, tjurunga, voodoo ( A sorcerer's spell, hex; 3. A hexed object)3) Jargon: mui (в виде чертовой головы или крошечной змейки и т.п.), mojo -
11 заговор
1) General subject: cabal (дворцовый), complot, exorcism, hex, junto, mine, plot, spell, confederacy, incantation2) Colloquial: set-up3) Religion: charm4) Law: alliance, confederation, conspiration (политический), plot (политический)5) Australian slang: boomerang7) Makarov: scheme -
12 пение
-
13 песнь
1) General subject: canticle, canto (часть поэмы), cantus, duan (часть эпической поэмы), incantation, lay, warble2) Poetical language: chant3) Bookish: passus5) Music: air6) Christianity: hymn -
14 заклинание
с.invocation; exorcism (by incantation); ( слова) spell -
15 наговор
-
16 колдовство
sorcery, witchcraft; magic, glamour перен. (очарование)* * ** * *sorcery, witchcraft; magic, glamour перен.* * *bewitcherybewitchmentcantripconjurationdiabolismenchantmentincantationmagicmedicinepishoguesortilegespelltheurgyvoodoowitcherywizardry -
17 чары
мн.
sorcery ед.; magic, charms прям. и перен.* * ** * *sorcery ед.; magic, charms и перен.* * *bewitchmentbewitchmentscharmincantationju-jumagicspellwitchcraftwitchcraftswitchery -
18 заклинание
spell, incantationРусско-английский глоссарий христианской лексики > заклинание
-
19 гимн
1) (церк. песнопение в Зап. христ-ве, которое исполняется во время богослужения, но не является молитвой) hymn(s); тж. катол. sequence, proseгимн из Песни трёх отроков (начинается словами: "Благословите, все дела Господни, Го́спода"; катол., лат. "Benedicite, omnia opera Domini"; англик. (из "Книги общественного богослужения") "O all ye Works of the Lord, bless ye the Lord!") — the Benedicite
гимн-похвала Богу, гимн, прославляющий Бога — theody
изучение церк. гимнов — hymnody
исполнение церк. гимнов — hymnody
магические гимны — theurgic hymns, songs of incantation
новозаветные гимны Девы Марии, Захарии и Симеона — major canticles
относящийся к церк. гимнам прил. — hymnal
сборник церк. гимнов — hymnal, редко hymnarium, hymnary
собрание церк. гимнов собир. — hymnody, hymnology
сочинитель церк. гимнов — hymnographer, hymnologist, hymnwriter, hymn maker
2) (духовная хоральная композиция, исполняемая церк. хором обычно на слова из Священного Писания) anthemгимн или часть гимна, исполняемый одним певцом (в англ. церк. музыке) — verse anthem
гимн, исполняемый (полностью) хором — full anthem
-
20 заговор
(заклинание, словесная формула, имеющая, по суеверным представлениям, чудодейственное свойство влиять на естественный ход событий, напр. при лечении болезни) incantation
- 1
- 2
См. также в других словарях:
Incantation — Основная информация … Википедия
incantation — [ ɛ̃kɑ̃tasjɔ̃ ] n. f. • XIIIe; bas lat. incantatio, de incantare → enchanter 1 ♦ Emploi de paroles magiques pour opérer un charme, un sortilège; ces paroles. ⇒ enchantement, évocation. « L incantation peut participer à la fois du commandement et… … Encyclopédie Universelle
Incantation — Datos generales Origen Johnstown, Pennsylvania Estados Unidos … Wikipedia Español
Incantation — In can*ta tion, n. [L. incantatio, fr. incantare to chant a magic formula over one: cf. F. incantation. See {Enchant}.] [1913 Webster] 1. The act or process of using formulas sung or spoken, with occult ceremonies, for the purpose of raising… … The Collaborative International Dictionary of English
Incantation — Allgemeine Informationen Genre(s) Death Metal Gründung 1989 Website http://www.incantation.com … Deutsch Wikipedia
incantation — [in΄kan tā′shən, in΄kəntā′shən] n. [ME incantacion < OFr incantation < LL incantatio < pp. of L incantare < in (intens.) + cantare: see CHANT] 1. the chanting of words or formulas that are believed to cast a spell or perform other… … English World dictionary
Incantation — Incantation, lat. deutsch, Bezauberung; incantiren, bezaubern … Herders Conversations-Lexikon
incantation — (n.) late 14c., from O.Fr. incantacion spell, exorcism (13c.), from L. incantationem (nom. incantatio) art of enchanting, noun of action from pp. stem of incantare bewitch, charm, lit. sing spells (see ENCHANTMENT (Cf. enchantment)) … Etymology dictionary
incantation — [n] spell, magic abracadabra*, ala kazam*, bewitchment, black magic, chant, charm, conjuration, conjuring, enchantment, formula, hex, hocus pocus*, hoodoo*, hymn, invocation, mumbo jumbo*, necromancy, open sesame*, rune, sorcery, voodoo*,… … New thesaurus
incantation — Incantation. s. f. Enchantement. Faire des incantations … Dictionnaire de l'Académie française
incantation — ► NOUN ▪ words said as a magic spell or charm. DERIVATIVES incantatory adjective. ORIGIN Latin, from incantare chant, bewitch … English terms dictionary