-
1 интервал
1) General subject: breach, break, gap, interim, interregnum, interspace, interval, parenthesis, space, span, spacing ( in a document)3) Military: gap, intervening gap4) Engineering: distance, domain, following distance (между автомобилями), head (между автомобилями), headway (на транспорте), latitude (фотографическая), period, step (шкалы), window, zone (ствола скважины)5) Chemistry: band, separation6) Mathematics: class (значений), cycle (времени), doubly infinite interval, horizon, monospace, open interval7) Railway term: interstice, margin (между поездами)9) Accounting: bracket (значений)10) Automobile industry: margin (между автомобилями)11) Mining: headway (между автомобилями), space interval12) Cinema: slot13) Metallurgy: intermediate space14) Electronics: sound interval15) Information technology: domain (времени), dwell (для принятия решений), extent, lag (времени), spanning, timeslice16) Oil: interval (расстояние по вертикали между двумя точками ствола скважины), section (в скважине), spot (цементирования, прострела, закрытия воды, кислотной обработки), zone (в скважине), spacing17) Geophysics: bandwidth, clearance, gate, region18) Silicates: (температурный) range19) Metrology: (пространственный или временной) spacing20) Ecology: time step, working time interval22) EBRD: bubble trades23) Polymers: margin25) Quality control: class (значении)26) Makarov: arm, bay, belt (в статистике), diapason, division, dwell (выделенный для принятия решения), gamut, gap (расстояние), head (на транспорте), in-between, length, offtime (напр. между импульсами), path, range (диапазон), region (диапазон), run, separation (расстояние), slot (в системах с временным разделением), spacing (линии связи), spacing (расстояние), span (линии связи), width27) Gold mining: intersept -
2 ширина шва
1) Engineering: joint clearance, joint margin, seam margin2) Construction: joint gap width3) Sowing: margin4) Cement: joint opening -
3 полоса
1) General subject: band, bar, fascia, field, frequence band, heatwave, hi-lo-band, marge, margin, page, period (Бессмысленная полоса напряжения в отношениях - pointless period of tension in a relationship - think of black and white stripes (полосы) that a relationship drives across), plate, run, series (a series of stamps (coins) - серия марок (монет)), stripe, tract, wale (от удара плетью, прутом), weal (от удара плетью, прутом), welt, wheal (от удара плетью), width, zone, column (Newspaper column), patch (rough / sticky patch - полоса напряжения в отношениях)2) Geology: ribbon5) Military: area, (патронная) belt, corridor, front (наступления, обороны), sector, spectrum (частот), window6) Engineering: fringe, passband (пропускания), piece, reed stripe (дефект проката), section bar, sheet, sideband (боковая), strap iron, stretch, stringer (вид переноса материала при трении), stripe (цветовая линия), tape, trail9) Automobile industry: billot10) Architecture: plate (металла, стекла и т.п.), zone (в значении "район", "местность")12) Mining: rib, ribbing (угля), split (при выемке)13) Road works: lane, traffic lane (движения)14) Forestry: lane (деревьев)15) Polygraphy: bar (напр. краски), page (набора), (отпечатанная) page ribbon, page-boy, printed side, sliver18) Oil: stria19) Communications: (информационная) bar20) Fishery: streak (на поверхности воды)24) Sowing: list25) Drilling: region26) Sakhalin energy glossary: flat bar27) Polymers: fringe (интерференционная)28) Automation: (интерференционная) fringe, strapping29) Robots: pass (пропускания)30) Arms production: knife blank (ножа)32) Makarov: band (напр. частот), band (напр., частот), bar (света, цвета), bar (сортового металла), beam, belt (пояс, зона), frequency band, frequency range, lamel, lamella, page ribbon (отпечатанная), reach (территории), slip, strand, streak (суши или воды), strip (узкая пластинка, удлинённый кусок, напр. металла, ткани и т.п.)33) Melioration: bed (площадь между двумя соседними разъёмными бороздами)34) Internet: Bandwidth (Диапазон частот, передаваемых через данное устройство или среду. Более широкая полоса позволяет передать больше информации в единицу времени)35) SAP.tech. horizontal bar -
4 полоса
1) stripe, streak; strip; band, flat bar (железа и т.д.)
2) (от удара кнутом и т.п.) wale
3) (область) region* * ** * *stripe, streak; strip; band, flat bar* * *barbillotfasciamarginstreakstripstripewidth -
5 полоса
band имя существительное:
См. также в других словарях:
Margin of error — This article is about the statistical precision of estimates from sample surveys. For safety margins in engineering, see Factor of safety. For tolerance in engineering, see Tolerance (engineering). Not to be confused with Margin for Error. The… … Wikipedia
Margin (typography) — A diagram displaying equal margins of width 25mm on an A4 page. In typography, a margin is the space that surrounds the content of a page.[1] The margin helps to define where a line of text begins and ends. When a page is justified the text is… … Wikipedia
margin stop — noun or marginal stop : either of the stops (as on a typewriter) that limit the range of the printing and determine the width of the margins … Useful english dictionary
valve margin — The width of the edge of the valve head between the top of the valve and the edge of the face. Too narrow a margin results in preignition and valve damage through over heating … Dictionary of automotive terms
suborbital width — least distance between the orbit and the lower suborbital or preorbital margin … Dictionary of ichthyology
List of Yellowcard band members — Yellowcard is a pop punk band founded in 1997 in Jacksonville, Florida. Throughout the band s history, Yellowcard has only had one consistant member, being drummer Longineu W. Parsons III. This is a timeline of all of the band members since their … Wikipedia
Duktales Karzinom in situ — Klassifikation nach ICD 10 D05.1 Carcinoma in situ der Milchgänge … Deutsch Wikipedia
Turkey Run State Park — Turkey Run Designation State Park Location Indiana USA Nearest City Marshall, Indiana Coordinates coord|39|53.1|N|87|12.2|W|type:landmark region:US Area 2,382 acres Date of Establishment 1916 … Wikipedia
Potato Creek State Park — Potato Creek Designation State Park Location Indiana USA Nearest City North Liberty, Indiana Coordinates coord|41|55|N|86|35|W|type:landmark region:US Area 3,840 acres Date of Establishment 1969 Gov … Wikipedia
White River State Park — Designation State Park Location Indiana USA Nearest City Indianapolis, Indiana Area 250 acres Date of Establishment 1979 Governing Body [http://www.in.gov/whiteriver/about/admin.htm … Wikipedia
Summit Lake State Park — Summit Lake Designation State Park Location Indiana USA Nearest City New Castle, Indiana Coordinates coord|40|02|N|85|33|W|type:landmark region:US Area 2,680 acres Date of Establishment 1988 Governing Body … Wikipedia
