-
1 moisture level
1) Техника: уровень влажности2) Парфюмерия: уровень содержания влаги3) Холодильная техника: влажность4) Макаров: содержание влаги (в почве) -
2 moisture level
English-Russian perfumery & beauty care dictionary > moisture level
-
3 moisture
влага; влажность -
4 back-scatter nuclear moisture meter
English-Russian dictionary on nuclear energy > back-scatter nuclear moisture meter
-
5 nuclear moisture meter
English-Russian dictionary on nuclear energy > nuclear moisture meter
-
6 isotope level meter
радиоизотопный уровнемер; радионуклидный уровнемер; уровнемер на основе радионуклидаEnglish-Russian dictionary on nuclear energy > isotope level meter
-
7 nuclear level meter
радиоизотопный уровнемер; радионуклидный уровнемер; уровнемер на основе радионуклидаEnglish-Russian dictionary on nuclear energy > nuclear level meter
-
8 meter
1) метр2) измерительный прибор, измеритель || измерять, мерить, замерять3) счётчик4) дозатор•to meter in — регулировать объём на входе;-
absorption frequency meter
-
ac meter
-
acoustic current meter
-
active energy meter
-
activity meter
-
admittance meter
-
airflow meter
-
air meter
-
all-purpose meter
-
alpha meter
-
alpha survey meter
-
altitude meter
-
ampere-hour meter
-
analog meter
-
angle meter
-
apparent energy meter
-
atrain meter
-
attenuation meter
-
audio level meter
-
audio-frequency meter
-
audio-noise meter
-
automatic noise figure meter
-
autoranging meter
-
backscatter nuclear density meter
-
backscatter nuclear moisture meter
-
badge meter
-
batch meter
-
battery meter
-
bellow gas meter
-
beta survey meter
-
B-H meter
-
body tilt meter
-
brightness meter
-
Btu meter
-
bypasswater meter
-
bypass meter
-
call-count meter
-
calometric gas meter
-
candle power meter
-
capacitance capacity meter
-
capacitance meter
-
cavity frequency meter
-
circuit noise meter
-
clamp-on meter
-
clip-on meter
-
coaxial-line frequency meter
-
coercive force meter
-
contamination meter
-
correlation meter
-
coulomb meter
-
counting-rate meter
-
counting-type frequency meter
-
course meter
-
cup-type meter
-
current meter
-
curve-drawing meter
-
cycloidal gas meter
-
dc meter
-
decibel meter
-
demand meter
-
density meter
-
depth meter
-
detonation meter
-
dew-point meter
-
dew-point moisture meter
-
dielectric-type moisture meter
-
differential pressure meter
-
digital meter
-
digital panel meter
-
digital Z meter
-
dip meter
-
direct-reading meter
-
distance meter
-
distortion factor meter
-
distortion meter
-
dosage meter
-
dose meter
-
double-rate meter
-
double-tariff meter
-
downhole oil gravity-gas content-volume ratio meter
-
draft meter
-
drift meter
-
dry gas meter
-
dual meter
-
dwell meter
-
earth resistance meter
-
edgewise meter
-
elbow meter
-
electric field meter
-
electric hour meter
-
electric power meter
-
electrical meter
-
electric meter
-
electricity meter
-
electrodynamic meter
-
electrolytic meter
-
electromagnetic current meter
-
electromagnetic interference meter
-
electromagnetic meter
-
electromechanical frequency meter
-
electronic moisture meter
-
elevation meter
-
energy meter
-
envelope delay meter
-
exposure meter
-
exposure rate meter
-
fallout meter
-
ferrodynamic meter
-
field-intensity meter
-
field-strength meter
-
flow meter
-
flow rate meter
-
fluid meter
-
fluidity meter
-
flux meter
-
flux-gate meter
-
foot-candle meter
-
forward scatter visibility meter
-
fountain-pen-type dose meter
-
frequency deviation meter
-
frequency meter
-
frequency modulation meter
-
frequency-indicating meter
-
fuel-flow meter
-
G.-M. meter
-
gamma meter
-
gamma survey meter
-
gas meter
-
gas volume meter
-
generating electric field meter
-
gravity meter
-
grid-dip meter
-
hardness meter
-
haze meter
-
head meter
-
heat meter
-
hook-on meter
-
hot-wire air flow meter
-
hot-wire meter
-
house service meter
-
humidity meter
-
hydraulic flow meter
-
hysteresis meter
-
illumination meter
-
impedance meter
-
impeller current meter
-
impulse meter
-
inductance meter
-
induction flow meter
-
induction-type meter
-
infrared moisture meter
-
in-line meter
-
instrument test meter
-
insulation-resistance meter
-
integrating electricity meter
-
integrating light meter
-
integrating meter
-
ion meter
-
iron-vane meter
-
lambda meter
-
laminar flow meter
-
laser-Doppler current meter
-
layer thickness meter
-
leakage meter
-
level meter
-
light meter
-
light-intensity meter
-
lightning-current meter
-
linear meter
-
liquid displacement meter
-
loss meter
-
luminance meter
-
lux meter
-
Mach meter
-
magnetic potential meter
-
magnetic-field meter
-
magnetic meter
-
magnetic-vane meter
-
mass-flow meter
-
maximum-demand meter
-
maxwell meter
-
megohm meter
-
methane meter
-
microwave power meter
-
milliohm meter
-
moisture meter
-
motor meter
-
moving-coil meter
-
moving-iron meter
-
multiple purpose meter
-
multiprobe ionization meter
-
multirange meter
-
multirate meter
-
multistator watt-hour meter
-
neutron soil moisture meter
-
noise-level meter
-
noise meter
-
noise-temperature meter
-
nuclear density meter
-
nuclear level meter
-
nuclear moisture meter
-
null meter
-
oil meter
-
orifice meter
-
output power meter
-
panel meter
-
parking meter
-
peak program meter
-
pendulum-type current meter
-
penny-in-the-slot meter
-
permanent-magnet meter
-
pH meter
-
phase-angle meter
-
phase meter
-
photoelectric exposure meter
-
photoelectric meter
-
photographic exposure meter
-
pivoted flap flow meter
-
pocket meter
-
polyphase meter
-
portable hydraulic flow meter
-
portable meter
-
power meter
-
power-factor meter
-
prepayment electricity meter
-
prepayment meter
-
pressure meter
-
printing meter
-
profile meter
-
profiling current meter
-
propeller meter
-
propeller milk meter
-
propeller-type meter
-
proportional gas meter
-
proportioning meter
-
Pygmy meter
-
quality-factor meter
-
quotient meter
-
radiation balance meter
-
radiation meter
-
radio-noise meter
-
rate meter
-
ratio meter
-
reactance meter
-
reactive volt-ampere meter
-
reactive volt-ampere-hour meter
-
reactive-energy meter
-
reactive-power meter
-
readout meter
-
recording depth meter
-
recording meter
-
reed frequency meter
-
residential meter
-
resistance meter
-
resistance-type moisture meter
-
resistivity meter
-
resonant frequency meter
-
revolution meter
-
rf level meter
-
roentgen rate meter
-
rotary gas meter
-
rotor current meter
-
running meter
-
salinity meter
-
salt meter
-
selective ion meter
-
self-recording current meter
-
service meter
-
setup scale meter
-
shape meter
-
sinad meter
-
single-phase meter
-
slip meter
-
S-meter
-
soap film meter
-
solid-state meter
-
sound-level meter
-
standard meter
-
standing-wave meter
-
steam-consumption meter
-
steam-flow meter
-
sulfur meter
-
summation meter
-
suppressed-zero meter
-
survey meter
-
switchboard meter
-
thermal electric meter
-
thermal meter
-
Thomson meter
-
three-axis current meter
-
three-phase meter
-
tide meter
-
torque meter
-
torsion meter
-
transmission nuclear density meter
-
transmission nuclear moisture meter
-
transmittance meter
-
transparency meter
-
trim meter
-
tuning meter
-
two-rate meter
-
var-hour meter
-
vector-averaging current meter
-
velocity-type meter
-
Ventury meter
-
vibrating-reed frequency meter
-
vibration meter
-
visibility meter
-
visual exposure meter
-
voltage meter
-
voltage standing-wave-ratio meter
-
volt-ampere meter
-
volt-ampere-hour meter
-
volt-ohm meter
-
volt-ohm-milliampere meter
-
water meter
-
watercut meter
-
water-sealed gas meter
-
watt-hour meter
-
wattless component meter
-
wave meter
-
wet gas meter
-
wind meter
-
wing current meter
-
Z meter
-
zero-center meter
-
zeta meter -
9 meter
1) метр
2) метровый
3) измеритель
4) прибор измерительный
5) устройство измерительное
6) счетчик
7) измерять
8) дозировать
– ampere-hour meter
– attenuation meter
– audibility meter
– bearing meter
– call meter
– capacitance meter
– clock meter
– color-difference meter
– count-rate meter
– crosstalk meter
– cubic meter
– current meter
– cut meter
– distortion meter
– drift meter
– dynamic meter
– eccentricity meter
– effective-call meter
– electricity meter
– end standard of meter
– error meter
– exposure meter
– field-intensity meter
– flow meter
– frequency meter
– frequency-deviation meter
– gas meter
– induction meter
– ion meter
– meter des archives
– meter display
– meter key
– meter of mercury
– misread a meter
– modulation meter
– moisture meter
– output meter
– peg count meter
– per meter
– power meter
– quality-factor meter
– radioactivity meter
– rate meter
– register of meter
– reverberation meter
– running meter
– sea current meter
– signal-strength meter
– square meter
– standard meter
– time meter
– totalizing meter
– traffic meter
– var-hour meter
– vibration meter
– visibility meter
– volt-ampere-hour meter
– volume-unit meter
– watt-hour meter
– wet water meter
– wet-gas meter
frequency deviation meter — <tech.> стабилометр частоты
international prototype meter — международный прототип метра
photo-electric exposure meter — фотоэлектрический экспонометр
signal strength meter — < radio> измеритель силы сигнала
sound level meter — измеритель силы звука, < radio> импульсмессер
standard meter bar — <math.> метр архивный
-
10 meter
1) счётчик; измерительный прибор; дозатор2) см. metre3) дозировать; измерять•- airflow meter - batch meter - bypass meter - bypass water meter - consistency meter - current meter - deflection meter - displacement meter - elevation meter - flow meter - free chlorine meter - gas meter - gradient meter - in-line meter - radiation meter - ride meter - slip meter - sound-level meter - velocity-type meter* * *измерительный прибор, счётчик- air content meter
- air meter
- air entrainment meter
- air flow meter
- air test meter
- apportioning heat meter
- batch water meter
- Carlson stress meter
- cement meter with ticket printout
- concrete maturity meter
- cover meter
- cup-type current meter
- current meter
- DB meter
- dosage meter
- dust meter
- electricity meter
- electric meter
- electronic distance meter
- elevation meter
- evaporative heat meter
- flow meter
- Fulmer tension meter
- gas meter
- heat meter
- heat flow meter
- humidity meter
- inferential shunt heat meter
- inferential water meter
- in-line air flow meter
- integrating flow meter
- integrating heat meter
- light meter
- mass flow meter
- Menard pressure meter
- mini texture meter
- moisture meter
- neutron moisture meter
- noise meter
- nozzle meter
- orifice meter
- parking meter
- pH meter
- pocket shear meter
- portable shear meter
- positive displacement meter
- primary meter
- pygmy meter
- road roughness meter
- rotary meter
- service meter
- short-range electronic distance meter
- slope meter
- sound-level meter
- speedy moisture meter
- thermal comfort meter
- transmission-type nuclear density meter
- turbine flow meter
- Venturi meter
- vibration meter
- water-service meter
- water meter
- Watt hour meter -
11 indicator
1) индикатор; указатель3) стрелка; указатель ( измерительного прибора)5) вчт. индикаторный регистр•-
acceleration indicator
-
acid-base indicator
-
adjustable indicator
-
air cleaner service indicator
-
airfield surface movement indicator
-
air-position indicator
-
airspeed indicator
-
alphanumeric indicator
-
alphameric indicator
-
altitude indicator
-
altitude-limit indicator
-
analog/digital indicator
-
anchor cable indicator
-
angle of attack indicator
-
antenna position indicator
-
approach slope indicator
-
attack angle indicator
-
attitude director indicator
-
attitude indicator
-
audio indicator
-
availability indicator
-
axle load indicator
-
azimuth-elevation indicator
-
balance indicator
-
bank-and-pitch indicator
-
banner indicator
-
bar-graph indicator
-
bar indicator
-
baro data indicator
-
battery charge indicator
-
beam indicator
-
bearing indicator
-
beat indicator
-
bin-level indicator
-
biological indicator
-
blast indicator
-
blown fuse indicator
-
boom angle indicator
-
burnout indicator
-
busy indicator
-
cable-fault indicator
-
cable-operated indicator
-
call indicator
-
camera speed indicator
-
capacitance level indicator
-
carbon ribbon supply indicator
-
cathode-ray tube indicator
-
cathode-ray indicator
-
cathode-ray tuning indicator
-
challenge indicator
-
character indicator
-
charge indicator
-
check indicator
-
circular scan indicator
-
climb-and-descent rate indicator
-
clogging indicator
-
color-change indicator
-
color indicator
-
compass repeater indicator
-
consumption indicator
-
contamination indicator
-
continuation indicator
-
continuous-reading indicator
-
continuous indicator
-
control position electric indicator
-
coolant level indicator
-
course deviation indicator
-
course direction indicator
-
course indicator
-
course-and-bearing indicator
-
cross-pointer indicator
-
CRT indicator
-
currency indicator
-
data indicator
-
dead reckoning indicator
-
deflection indicator
-
demand indicator
-
depth indicator
-
depth-of-field indicator
-
dew-point indicator
-
dial indicator
-
digital indicator
-
digital pressure indicator
-
direct indicator
-
direction indicator
-
direct-reading indicator
-
dirt indicator
-
discharge indicator
-
dome-temperature indicator
-
draft indicator
-
drift angle indicator
-
drift indicator
-
drilling efficiency indicator
-
electrical zero indicator
-
electrical-contact indicator
-
electroluminescent indicator
-
elevation-position indicator
-
end-of-file indicator
-
end-of-film run indicator
-
end-of-line indicator
-
end-of-page indicator
-
end-of-tape indicator
-
explosive-gas indicator
-
failure indicator
-
failure warning indicator
-
fault indicator
-
film footage indicator
-
filter bypass indicator
-
filter clogging indicator
-
filter differential pressure indicator
-
firedamp indicator
-
fixed-pointer indicator
-
fixed-scale indicator
-
flag indicator
-
flap position indicator
-
flash indicator
-
flight indicator
-
float level indicator
-
flow indicator
-
fluorescent indicator
-
flywheel runout indicator
-
fouling point indicator
-
frame indicator
-
free point indicator
-
frequency indicator
-
fuel indicator
-
fuse indicator
-
fusion-type indicator
-
gas indicator
-
gas-discharge indicator
-
glass level indicator
-
glow-discharge indicator
-
ground indicator
-
ground-position indicator
-
guest-host indicator
-
heading indicator
-
height-position indicator
-
height-range indicator
-
helm indicator
-
high-level indicator
-
hot-spot indicator
-
humidity indicator
-
icing indicator
-
illuminated indicator
-
indicator of pollution
-
in-lock indicator
-
instantaneous pressure indicator
-
interlock indicator
-
interrupt indicator
-
irreversible thermal indicator
-
isotopic indicator
-
jamming environment indicator
-
knock indicator
-
landing direction indicator
-
leakage indicator
-
LED indicator
-
level indicator
-
level-type indicator
-
light-emitting-diode indicator
-
limit indicator
-
line indicator
-
linear analog indicator
-
liquid-crystal indicator
-
local indicator
-
location indicator
-
log indicator
-
low fuel level indicator
-
luminescent indicator
-
machine check indicator
-
magazine orientation indicator
-
magnetic compass indicator
-
magnetic indicator for lightning current
-
malfunction indicator
-
mass-flow indicator
-
maximum demand indicator
-
measuring indicator
-
moisture indicator
-
movable-pointer indicator
-
movable-scale indicator
-
moving-target indicator
-
mud-flow indicator
-
multirange indicator
-
needle indicator
-
neon indicator
-
null indicator
-
null-frequency indicator
-
numerical indicator
-
numeric indicator
-
oil indicator
-
oil-level indicator
-
oil-pressure indicator
-
open-circuit indicator
-
operation indicator
-
operator indicator
-
optimum-shift-point indicator
-
oscillation indicator
-
overflow indicator
-
overload indicator
-
partial discharge indicator
-
passing signal indicator
-
patch indicator
-
peak indicator
-
phase indicator
-
phase rotation indicator
-
P-indicator
-
pit volume indicator
-
plan-position indicator
-
plasma indicator
-
pneumatic job setting indicator
-
point indicator
-
pointer indicator
-
polarity indicator
-
position indicator
-
potential indicator
-
power indicator
-
power ready indicator
-
power-factor indicator
-
power-level indicator
-
precipitation indicator
-
pressure indicator
-
pressure ratio indicator
-
priority message indicator
-
proximity warning indicator
-
radar indicator
-
radial-time-base indicator
-
radiation indicator
-
radio magnetic indicator
-
radioactivity indicator
-
range indicator
-
range-height indicator
-
rate-of-climb indicator
-
rate-of-flow indicator
-
reference indicator
-
remote indicator
-
remote power indicator
-
reset-type filter indicator
-
reversible thermal indicator
-
revolution indicator
-
ribbon advance indicator
-
ring indicator
-
rotating-drum indicator
-
route indicator
-
routing indicator
-
rudder angle indicator
-
rudder indicator
-
running notch indicator
-
runway alignment indicator
-
scale indicator
-
scene brightness indicator
-
scoring indicator
-
shadow tuning indicator
-
shorted-turn indicator
-
short-turn indicator
-
sign check indicator
-
signal strength indicator
-
skyline tension indicator
-
slave indicator
-
space target Doppler indicator
-
speed indicator
-
stability indicator
-
stack indicator
-
standing-wave indicator
-
state-of-charge indicator
-
status indicator
-
stock indicator
-
stop-light indicator
-
storm indicator
-
straingage indicator
-
strain indicator
-
stroke indicator
-
sun intensity indicator
-
sun-position indicator
-
switch indicator
-
synchro indicator
-
tank-level indicator
-
tap position indicator
-
temperature indicator
-
thickness indicator
-
thread indicator
-
tilt indicator
-
tire-wear indicator
-
tong-torque indicator
-
ton-mile indicator
-
top-center indicator
-
total volume indicator
-
track indicator
-
track-occupancy indicator
-
traffic indicator
-
train indicator
-
transmission test indicator
-
transmission-type indicator
-
trim indicator
-
trim tab indicator
-
tuned-reed indicator
-
tuning indicator
-
turn indicator
-
turn-and-bank indicator
-
turn-and-slip indicator
-
ultraviolet indicator
-
vacuum indicator
-
vertical-scale indicator
-
visible indicator
-
visual approach slope indicator
-
voltage indicator
-
voltage-deviation indicator
-
volume indicator
-
water-level indicator
-
weight-on-the-bit indicator
-
weight indicator
-
wind direction indicator
-
wind indicator
-
window-annunciator indicator
-
yaw indicator
-
zone-beat indicator -
12 meter
1) метр || метровый2) измеритель || измерять3) измерительный прибор; измерительное устройство4) счётчик•- displacement water meter - field survey meter - free-flow water meter - modulation index meter - propeller water meter- Vu meter -
13 capacity
вместимость, объём, ёмкость, производительность; пропускная способность; выход; выработка; эффект; грузоподъёмность; мощность номинальная, максимально допустимая мощность; предельные габаритные размеры; электрическая ёмкость; способность; свойство, качество, состояние; величина работы•
- absorption capacity
- adhesive capacity
- available capacity
- basic capacity
- bearing capacity
- bucket capacity
- calorific capacity
- cargo capacity
- carring capacity
- carring capacity of pillar
- carring capacity of pipe
- charge capacity
- climbing capacity
- coking capacity
- combining capacity
- computed capacity
- cubic capacity
- cutting capacity
- daily capacity
- dipper capacity
- discharge capacity
- designed capacity
- dielectric capacity
- draw-bar capacity
- drilling capacity
- dry capacity
- dust-storage capacity
- exchange capacity
- floatation capacity
- flow capacity
- hauling capacity
- heap capacity
- heating capacity
- hourly capacity
- hourly handling capacity
- idle capacity
- labour capacity
- level capacity
- lifting capacity
- live capacity
- load capacity
- load-carrying capacity
- loading capacity
- medium-capacity
- mine capacity
- moisture capacity
- molecular moisture capacity
- output capacity of mine
- overload capacity
- pay-load capacity
- pipe capacity
- powder capacity
- productive capacity
- pumping capacity
- rated capacity
- reserve capacity
- rope capacity
- safe load capacity
- sand-raking capacity
- saturation capacity
- scoop capacity
- scraper capacity
- scraper struck capacity
- screen capacity
- shaft capacity
- skip capacity
- soil bearing capacity
- specific capacity
- storage capacity
- strain capacity
- struck bucket capacity
- struck level capacity
- supporting capacity
- tested capacity
- therm capacity
- traffic capacity
- vital capacity
- water capacity
- working capacity -
14 MSL
1) Компьютерная техника: Marvel Strategy Language, Model Specification Language2) Авиация: средний уровень моря (AD)3) Морской термин: Maximum Securing Load (a term used to define the allowable load capacity for a device used to secure cargo to a ship)4) Американизм: Minimum Subsistence Level5) Спорт: Mechanized Skirmish League, Mid State League6) Военный термин: Military School of Languages, maintenance supply liaison, manpower source listing, master support list, maximum service life, measurement standards laboratory, military shipping label, military support list7) Техника: main steamline, maximum still-water level8) Шутливое выражение: Mew's Secret Land, Mews Secret Land9) Математика: медианный уровень значимости (median significance level)10) Сокращение: Manned Space Laboratory, Master of Sciences in Linguistics, Mean Sea Level, Moisture Sensitivity Level11) Электроника: Modify system logging12) Вычислительная техника: Microsoft Software Library (Internet, MS), Maximum Segment Lifetime (TCP/IP)13) Нефть: M sea level, максимальный срок службы (maximum service life)14) Космонавтика: materials science laboratory15) Фирменный знак: Marks Spencer Lingerie16) Глоссарий компании Сахалин Энерджи: СУМ (Mean Sea Level)17) Образование: Multi Sensory Learning18) Сетевые технологии: Mirrored Server Link, manufacturer suggested list price, канал связи зеркально отображаемых серверов, канал связи отражённых серверов19) Автоматика: Modicon State Language20) Медицинская техника: Measurement Server Link (Philips)21) Расширение файла: Map Specification Library22) Нефть и газ: MV scale low limit, medium sea level, scale low limit for MV23) Аэропорты: Muscle Shoals, Alabama USA24) Парашютный спорт: уровень моря -
15 msl
1) Компьютерная техника: Marvel Strategy Language, Model Specification Language2) Авиация: средний уровень моря (AD)3) Морской термин: Maximum Securing Load (a term used to define the allowable load capacity for a device used to secure cargo to a ship)4) Американизм: Minimum Subsistence Level5) Спорт: Mechanized Skirmish League, Mid State League6) Военный термин: Military School of Languages, maintenance supply liaison, manpower source listing, master support list, maximum service life, measurement standards laboratory, military shipping label, military support list7) Техника: main steamline, maximum still-water level8) Шутливое выражение: Mew's Secret Land, Mews Secret Land9) Математика: медианный уровень значимости (median significance level)10) Сокращение: Manned Space Laboratory, Master of Sciences in Linguistics, Mean Sea Level, Moisture Sensitivity Level11) Электроника: Modify system logging12) Вычислительная техника: Microsoft Software Library (Internet, MS), Maximum Segment Lifetime (TCP/IP)13) Нефть: M sea level, максимальный срок службы (maximum service life)14) Космонавтика: materials science laboratory15) Фирменный знак: Marks Spencer Lingerie16) Глоссарий компании Сахалин Энерджи: СУМ (Mean Sea Level)17) Образование: Multi Sensory Learning18) Сетевые технологии: Mirrored Server Link, manufacturer suggested list price, канал связи зеркально отображаемых серверов, канал связи отражённых серверов19) Автоматика: Modicon State Language20) Медицинская техника: Measurement Server Link (Philips)21) Расширение файла: Map Specification Library22) Нефть и газ: MV scale low limit, medium sea level, scale low limit for MV23) Аэропорты: Muscle Shoals, Alabama USA24) Парашютный спорт: уровень моря -
16 meter
- meter
- nизмерительный прибор, счётчик
- air content meter
- air meter
- air entrainment meter
- air flow meter
- air test meter
- apportioning heat meter
- batch water meter
- Carlson stress meter
- cement meter with ticket printout
- concrete maturity meter
- cover meter
- cup-type current meter
- current meter
- DB meter
- dosage meter
- dust meter
- electricity meter
- electric meter
- electronic distance meter
- elevation meter
- evaporative heat meter
- flow meter
- Fulmer tension meter
- gas meter
- heat meter
- heat flow meter
- humidity meter
- inferential shunt heat meter
- inferential water meter
- in-line air flow meter
- integrating flow meter
- integrating heat meter
- light meter
- mass flow meter
- Menard pressure meter
- mini texture meter
- moisture meter
- neutron moisture meter
- noise meter
- nozzle meter
- orifice meter
- parking meter
- pH meter
- pocket shear meter
- portable shear meter
- positive displacement meter
- primary meter
- pygmy meter
- road roughness meter
- rotary meter
- service meter
- short-range electronic distance meter
- slope meter
- sound-level meter
- speedy moisture meter
- thermal comfort meter
- transmission-type nuclear density meter
- turbine flow meter
- Venturi meter
- vibration meter
- water-service meter
- water meter
- Watt hour meter
Англо-русский строительный словарь. — М.: Русский Язык. С.Н.Корчемкина, С.К.Кашкина, С.В.Курбатова. 1995.
-
17 control
1) управление; регулирование || управлять; регулировать2) контроль || контролировать3) управляющее устройство; устройство управления; регулятор4) профессиональное мастерство, квалификация, техническая квалификация5) pl органы управления•"in control" — "в поле допуска" ( о результатах измерения)
to control closed loop — управлять в замкнутой системе; регулировать в замкнутой системе
- 2-handed controlsto control open loop — управлять в разомкнутой системе; регулировать в разомкнутой системе
- 32-bit CPU control
- acceptance control
- access control
- acknowledge control
- active process control
- adaptable control
- adaptive constraint control
- adaptive control for optimization
- adaptive control
- adaptive feed rate control
- adaptive quality control
- adjustable feed control
- adjustable rotary control
- adjustable speed control
- adjusting control
- adjustment control
- AI control
- air logic control
- analog data distribution and control
- analogical control
- analytical control
- application control
- arrows-on-curves control
- autodepth control
- autofeed control
- automated control of a document management system
- automated technical control
- automatic backlash control
- automatic control
- automatic editing control
- automatic gain control
- automatic gripper control
- automatic level control
- automatic process closed loop control
- automatic remote control
- automatic sensitivity control
- automatic sequence control
- automatic speed control
- automatic stability controls
- auxiliaries control
- balanced controls
- band width control
- bang-bang control
- bang-bang-off control
- basic CNC control
- batch control
- bibliographic control
- bin level control
- boost control
- built-in control
- button control
- cam control
- cam throttle control
- camshaft control
- carriage control
- Cartesian path control
- Cartesian space control
- cascade control
- C-axis spindle control
- cell control
- center control
- central control
- central supervisory control
- centralized control
- centralized electronic control
- central-station control
- changeover control
- chip control
- circumferential register control
- close control
- closed cycle control
- closed loop control
- closed loop machine control
- closed loop manual control
- closed loop numerical control
- closed loop position control
- clutch control
- CNC control
- CNC indexer control
- CNC programmable control
- CNC symbolic conversational control
- CNC/CRT control
- CNC/MDI control
- coarse control
- coded current control
- coded current remote control
- color control
- combination control
- command-line control
- compensatory control
- composition control
- compound control
- computed-current control
- computed-torque control
- computer control
- computer numerical control
- computer process control
- computer-aided measurement and control
- computer-integrated manufacturing control
- computerized control
- computerized numerical control
- computerized process control
- constant surface speed control
- constant value control
- contactless control
- contact-sensing control
- contamination control
- continuous control
- continuous path control
- continuous process control
- contour profile control
- contouring control
- conventional hardware control
- conventional numerical control
- conventional tape control
- convergent control
- conversational control
- conversational MDI control
- coordinate positioning control
- coordinate programmable control
- copymill control
- counter control
- crossed controls
- current control
- cycle control
- dash control
- data link control
- data storage control
- deadman's handle controls
- depth control
- derivative control
- dial-in control
- differential control
- differential gaging control
- differential gain control
- differential temperature control
- digital brushless servo control
- digital control
- digital position control
- digital readout controls
- dimensional control
- direct computer control
- direct control
- direct digital control
- direct numerical control
- direction control
- directional control
- dirt control
- discontinuous control
- discrete control
- discrete event control
- discrete logic controls
- dispatching control
- displacement control
- distance control
- distant control
- distributed control
- distributed numerical control
- distributed zone control
- distribution control
- dog control
- drum control
- dual control
- dual-mode control
- duplex control
- dust control
- dynamic control
- eccentric control
- edge position control
- EDP control
- electrical control
- electrofluidic control
- electromagnetic control
- electronic control
- electronic level control
- electronic speed control
- electronic swivel control
- elevating control
- emergency control
- end-point control
- engineering change control
- engineering control
- entity control
- environmental control
- error control
- error plus error-rate control
- error-free control
- external beam control
- factory-floor control
- false control
- feed control
- feed drive controls
- feedback control
- feed-forward control
- field control
- fine control
- finger-tip control
- firm-wired numerical control
- fixed control
- fixed-feature control
- fixture-and-tool control
- flexible-body control
- floating control
- flow control
- fluid flow control
- follow-up control
- foot pedal control
- force adaptive control
- forecasting compensatory control
- fork control
- four quadrant control
- freely programmable CNC control
- frequency control
- FROG control
- full computer control
- full order control
- full spindle control
- gage measurement control
- gain control
- ganged control
- gap control
- gear control
- generative numerical control
- generic path control
- geometric adaptive control
- graphic numerical control
- group control
- grouped control
- guidance control
- hairbreath control
- hand control
- hand feed control
- hand wheel control
- hand-held controls
- handle-type control
- hand-operated controls
- hardened computer control
- hardwared control
- hardwared numerical control
- heating control
- heterarchical control
- hierarchical control
- high-integrity control
- high-level robot control
- high-low control
- high-low level control
- high-technology control
- horizontal directional control
- humidity control
- hybrid control
- hydraulic control
- I/O control
- immediate postprocess control
- inching control
- in-cycle control
- independent control
- indexer control
- indirect control
- individual control
- industrial processing control
- industrial-style controls
- infinite control
- infinite speed control
- in-process control
- in-process size control
- in-process size diameters control
- input/output control
- integral CNC control
- integral control
- integrated control
- intelligent control
- interacting control
- interconnected controls
- interlinking control
- inventory control
- job control
- jogging control
- joint control
- joystick control
- just-in-time control
- language-based control
- laser health hazards control
- latching control
- lead control
- learning control
- lever control
- lever-operated control
- line motion control
- linear control
- linear path control
- linearity control
- load control
- load-frequency control
- local control
- local-area control
- logic control
- lubricating oil level control
- machine control
- machine programming control
- machine shop control
- macro control
- magnetic control
- magnetic tape control
- main computer control
- malfunction control
- management control
- manual control
- manual data input control
- manual stop control
- manually actuatable controls
- manufacturing change control
- manufacturing control
- master control
- material flow control
- MDI control
- measured response control
- mechanical control
- memory NC control
- memory-type control
- metering control
- metrological control of production field
- microbased control
- microcomputer CNC control
- microcomputer numerical control
- microcomputer-based sequence control
- microprocessor control
- microprocessor numerical control
- microprogrammed control
- microprogramming control
- milling control
- model reference adaptive control
- model-based control
- moisture control
- motion control
- motor control
- motor speed control
- mouse-driven control
- movable control
- multicircuit control
- multidiameter control
- multilevel control
- multimachine tool control
- multiple control
- multiple-processor control
- multiposition control
- multistep control
- multivariable control
- narrow-band proportional control
- navigation control
- NC control
- neural network adaptive control
- noise control
- noncorresponding control
- noninteracting control
- noninterfacing control
- nonreversable control
- nonsimultaneous control
- numerical contouring control
- numerical control
- numerical program control
- odd control
- off-line control
- oligarchical control
- on-board control
- one-axis point-to-point control
- one-dimensional point-to-point control
- on-line control
- on-off control
- open loop control
- open loop manual control
- open loop numerical control
- open-architecture control
- operating control
- operational control
- operator control
- optical pattern tracing control
- optimal control
- optimalizing control
- optimizing control
- oral numerical control
- organoleptic control
- overall control
- overheat control
- override control
- p. b. control
- palm control
- parameter adaptive control
- parameter adjustment control
- partial d.o.f. control
- path control
- pattern control
- pattern tracing control
- PC control
- PC-based control
- peg board control
- pendant control
- pendant-actuated control
- pendant-mounted control
- performance control
- photoelectric control
- physical alignment control
- PIC control
- PID control
- plugboard control
- plug-in control
- pneumatic control
- point-to-point control
- pose-to-pose control
- position/contouring numerical control
- position/force control
- positional control
- positioning control
- positive control
- postprocess quality control
- power adaptive control
- power control
- power feed control
- power-assisted control
- powered control
- power-operated control
- precision control
- predictor control
- preselective control
- preset control
- presetting control
- pressbutton control
- pressure control
- preview control
- process control
- process quality control
- production activity control
- production control
- production result control
- programmable adaptive control
- programmable cam control
- programmable control
- programmable logic adaptive control
- programmable logic control
- programmable machine control
- programmable microprocessor control
- programmable numerical control
- programmable sequence control
- proportional plus derivative control
- proportional plus floating control
- proportional plus integral control
- prototype control
- pulse control
- pulse duration control
- punched-tape control
- purpose-built control
- pushbutton control
- quality control
- radio remote control
- radium control
- rail-elevating control
- ram stroke control
- ram-positioning control
- rapid-traverse controls for the heads
- rate control
- ratio control
- reactive control
- real-time control
- reduced-order control
- register control
- registration control
- relay control
- relay-contactor control
- remote control
- remote program control
- remote switching control
- remote valve control
- remote-dispatch control
- resistance control
- resolved motion rate control
- retarded control
- reversal control
- revolution control
- rigid-body control
- robot control
- robot perimeter control
- robot teach control
- rod control
- safety control
- sampled-data control
- sampling control
- schedule control
- SCR's control
- second derivative control
- selective control
- selectivity control
- self-acting control
- self-adaptive control
- self-adjusting control
- self-aligning control
- self-operated control
- self-optimizing control
- self-programming microprocessor control
- semi-automatic control
- sensitivity control
- sensor-based control
- sequence control
- sequence-type control
- sequential control
- series-parallel control
- servo control
- servo speed control
- servomotor control
- servo-operated control
- set value control
- shaft speed control
- shape control
- shift control
- shop control
- shower and high-pressure oil temperature control
- shut off control
- sight control
- sign control
- single variable control
- single-flank control
- single-lever control
- size control
- slide control
- smooth control
- software-based NC control
- softwared numerical control
- solid-state logic control
- space-follow-up control
- speed control
- stabilizing control
- stable control
- standalone control
- start controls
- static control
- station control
- statistical quality control
- steering control
- step-by-step control
- stepless control
- stepped control
- stick control
- stock control
- stop controls
- stop-point control
- storage assignment control
- straight cut control
- straight line control
- stroke control
- stroke length control
- supervisor production control
- supervisory control
- swarf control
- switch control
- symbolic control
- synchronous data link control
- table control
- tap-depth controls
- tape control
- tape loop control
- teach controls
- temperature control
- temperature-humidity air control
- template control
- tension control
- test control
- thermal control
- thermostatic control
- three-axis contouring control
- three-axis point-to-point control
- three-axis tape control
- three-mode control
- three-position control
- throttle control
- thumbwheel control
- time control
- time cycle control
- time optimal control
- time variable control
- time-critical control
- time-proportional control
- timing control
- token-passing access control
- tool life control
- tool run-time control
- torque control
- total quality control
- touch-panel NC control
- touch-screen control
- tracer control
- tracer numerical control
- trajectory control
- triac control
- trip-dog control
- TRS/rate control
- tuning control
- turnstile control
- two-axis contouring control
- two-axis point-to-point control
- two-dimension control
- two-hand controls
- two-position control
- two-position differential gap control
- two-step control
- undamped control
- user-adjustable override controls
- user-programmable NC control
- variable flow control
- variable speed control
- variety control
- varying voltage control
- velocity-based look-ahead control
- vise control
- vision responsive control
- visual control
- vocabulary control
- vocal CNC control
- vocal numerical control
- voltage control
- warehouse control
- washdown control
- water-supply control
- welding control
- wheel control
- wide-band control
- zero set control
- zoned track controlEnglish-Russian dictionary of mechanical engineering and automation > control
-
18 automatic
автоматический аппарат; II автоматический; самодействующий; автоматизированный- automatic acceleration control unit - automatic accumulator charging - automatic action - automatic adjustment - automatic adjustment mechanism - automatic advance control - automatic air regulator - automatic alarm - automatic alarm signal transmitter - automatic alternation - automatic amplitude control - automatic arc welding - automatic arc welding machine - automatic arc-welding machine - automatic assemblage - automatic assembly - automatic assembly machine - automatic backing-up - automatic backlash control - automatic backup - automatic balance control - automatic balancer - automatic balancing - automatic bar fed turning center - automatic bar feed - automatic bias control - automatic block - automatic bonding unit - automatic brake - automatic brake adjuster - automatic brake arrangement - automatic brake controller - automatic braking - automatic braking system - automatic brazing equipment - automatic buffing machine - automatic burette - automatic butt splicer - automatic calibration - automatic cam-controlled machine - automatic cathead - automatic centering - automatic chain-bending machine - automatic change of tools - automatic change-over - automatic change-over switch - automatic check - automatic check-out recording equipment - automatic checking balance - automatic checking machine - automatic checkout equipment - automatic checkout system - automatic checkout-and-readiness equipment - automatic choke - automatic chuck - automatic chuck extractor - automatic chuck-changing system - automatic chuck jaw changing - automatic chucker - automatic circuit - automatic circuit breaker - automatic circuit recloser - automatic climate control system - automatic closing system - automatic clutch - automatic cold upsetter - automatic come-along clamp - automatic compensation option - automatic compensator - automatic consistency checking - automatic constant tension mooring winch - automatic control - automatic control actuator - automatic control channel - automatic control circuit - automatic control engineering - automatic control equipment - automatic control halting instruction - automatic control installation - automatic control loop - automatic control rod - automatic control system - automatic controller - automatic conveying - automatic coupler - automatic coupling - automatic coupling device - automatic coupling screwing unit - automatic crab winch - automatic crimper - automatic crossover - automatic cut-out torque wrench - automatic cutout - automatic cycle - automatic cycle mechanism - automatic cycle working - automatic cycling equipment - automatic data analyzer - automatic data distribution - automatic data entry - automatic data processing - automatic data processing field branch - automatic data unit - automatic datum search - automatic deicing system - automatic device - automatic diagnosis - automatic diagnostic-and-recovery system - automatic discharging device - automatic disk changer - automatic door - automatic door closer - automatic door photoelectric relay - automatic drilling control - automatic drilling rig - automatic drinking bowl - automatic drive - automatic drive detection - automatic drive engagement - automatic dump - automatic-dump truck - automatic dust ejector - automatic dust unloading valve - automatic ejection - automatic electric drive - electrical drive - automatic electrode changer - automatic elevator - automatic emergency valve - automatic end stop - automatic error correction - automatic error detection - automatic exchange of tools - automatic expansion valve - automatic fault detection - automatic fault finding - automatic fault isolation - automatic fault isolation tester - automatic fault reporting - automatic fault signalling - automatic feature - automatic feed - automatic feed drill - automatic feed-off mechanism - automatic feeder - automatic feeding mechanism - automatic feedoff - automatic fire alarm - automatic fire alarm system - automatic fire annunciator - automatic fire detector - automatic fire sprinkler - automatic fixturing system - automatic flanger - automatic float-type pump-out unit - automatic flour meter - automatic flow tank - automatic focus correction servo-system - automatic forging machine - automatic front wheel drive engagement - automatic fuel economizing device - automatic fuel-control unit - automatic fuel saving device - automatic fuel shut-off - automatic fuse - automatic gage - automatic gaging-and-compensating system - automatic gain adjustment - automatic gain control - automatic gas-cutting machine - automatic gas-welding machine - automatic gate - automatic gate closer - automatic gate opener - automatic gauging - automatic gearbox - automatic generating plant - automatic generator - automatic grab - automatic gripper change - automatic gripper control - automatic guided vehicle - automatic half-hose machine - automatic heater - automatic hill holder - automatic hinged trip spider - automatic hitch - automatic holding - automatic holding device - automatic hopper-feed machine - automatic humidity regulator - automatic identification- Auto-ID- AIS - automatic idling control - automatic ignition - automatic ignition system - automatic ignition timing - automatic input - automatic insertion - automatic interlocking - automatic internal diagnosis - automatic jaw changer - automatic jaw shift device - automatic latching - automatic level - automatic level compensation - automatic level control - automatic level control system - automatic level gauge - automatic level setup - automatic leveling control system - automatic light - automatic light control - automatic light regulation - automatic line - automatic line disconnection - automatic line switching - ALS - automatic load control - automatic load sustaining brake - automatic load-gripping device - automatic loader - automatic loading - automatic lock - automatic locking - automatic locking holder - automatic locking hub - automatic locking spindle - automatic lockout - automatic lockout feature - automatic lubrication - automatic lubricator - automatic machine cycle - automatic magazine bar feed - automatic maintenance - automatic manipulator - automatic measurement-and-compensation system - automatic measuring facilities - automatic metal forming machine - automatic mixture control - automatic mode switching - automatic moisture regulator - automatic monitoring - automatic motor control gear - automatic movements starting - automatic multicam machine - automatic noise limiter - automatic noise-reduction system - automatic oil-flow controller - automatic oiling - automatic opening circuit breaker - automatic opening cover - automatic optimization - automatic overload control - automatic overload limiter - automatic overload stop - automatic packing - automatic pallet handler - automatic pallet storage-retrieval system - automatic part gaging - automatic part-loading conveyor - automatic photodetector - automatic pipe handling system - automatic pipe stabber - automatic placement - automatic plant - automatic polishing machine - automatic positioning - automatic power control - automatic power drawbar control - automatic power rotary scraper - automatic power slips - automatic press for cold pressing of nuts - automatic press for stamping electric motor stator and rotor notches - automatic pressure control - automatic pressure regulator - automatic probe changer - automatic probe changing - automatic probing cycle - automatic punch - automatic rack stacker - automatic radiator shutter - automatic ram pile driver - automatic reading - automatic reclosing circuit breaker - automatic recovery - automatic recovery program - automatic regulation - automatic regulation of belt tension - automatic regulation of drive chain tension - automatic regulation rod - automatic regulator - automatic release - automatic releaser - automatic repeat - automatic remote control - automatic reset - automatic reset-data circuit - automatic restart - automatic return - automatic return valve - automatic rotary line - automatic router - automatic routine - automatic rpm changer - automatic safety device - automatic sample changer - automatic sampler - automatic sampling - automatic sampling device - automatic sampling equipment - automatic sand-blasting machine - automatic scales - automatic screen - automatic selective overdrive - automatic sensitivity control - automatic set point - automatic shaft-position data encoder - automatic shaker bag - automatic shank spindle - automatic shift - automatic shut-off valve - automatic shutdown - automatic side-dumping - automatic signaling - automatic signalization - automatic size control tooling - automatic sorting machine - automatic spark advance - automatic spark advance governor - automatic spark advance magneto - automatic spark timer - automatic spectrometer - automatic spectrophotometer - automatic speed compensation - automatic speed control - automatic speed selection device - automatic spider - automatic spindle gear changing - automatic sprinkler fire control system - automatic stability - automatic stability controls - automatic stabilization and control system - automatic stabilizer - automatic stacker crane - automatic start - automatic starting - automatic starting motor - automatic start-up - automatic steel - automatic steering - automatic step selection - automatic stop - automatic stop switch - automatic straightening and cutting machine - automatic strip-straightening machine - automatic submerged-arc welder - automatic submerged-arc welding - automatic sucker rod spanner - automatic suction pump - automatic surveillance - automatic switch - automatic switchable redundance - automatic switchboard - automatic swivel spindle - automatic synchronization - automatic synchronizer - automatic takeup - automatic takeup mechanism - automatic temperature recording controller - automatic temperature regulator - automatic tensioning winch - automatic test analysis system - automatic test equipment - automatic test system - automatic thrust adjustment - automatic time switch - automatic time-delay switch - automatic timed magneto - automatic timer - automatic timing - automatic timing control - automatic timing device - automatic tipper - automatic tool changing apparatus - automatic tool transport mechanism - automatic tool wear-tool broken sensing system - automatic toolsetting - automatic tongs - automatic training idler - automatic transmission - automatic transmission fluid - automatic trip - automatic troubleshooting - automatic tuning - automatic two-speed geared head - automatic update - automatic vacuum deposition system - automatic valve - automatic valve adjustment - automatic viscosity controller - automatic voltage control - automatic voltage regulator - automatic warehousing - automatic warning - automatic washer - automatic water bowl - automatic water spray fire-fighting system - automatic weight controller - automatic weighing machine - automatic weigher - automatic weld - automatic welder - automatic welding - automatic welding machine - automatic wire feed - automatic workhandling - automatic workhandling device - automatic zero adjustment - automatic zero set -
19 ML
1) Компьютерная техника: Markup Language, Memory Lock, Meta Language2) Спорт: Major League3) Военный термин: Management Level, Map List, Marshall Law, maintenance laboratory, maintenance level, manual loader, material list, medium lorry, military law, military liaison, military payroll money list, minelayer, minelaying, missile launch, missile launcher, missile layout, mission life, mission load, mobile laboratory, mobile land, mobile launcher, money list, motor launch, munitions list, muzzle loader, muzzle loading4) Техника: Microwave Laboratory, manufacturing license, mean life, molded line5) Сельское хозяйство: moisture loss6) Математика: максимальное правдоподобие (maximum likelihood)7) Лингвистика: machine learning8) Финансы: отмывание нелегальных доходов (money laundering)9) Автомобильный термин: среднее положение - низкая скорость10) Оптика: mode locked11) Политика: Mali, Marxist Leninist12) Сокращение: (type abbreviation) Minelayer (Ocean; O), Magic LANTIRN Adaptation (A), Magic Lantern (Adaptation; A), Magic Lantern (Airborne mine detection system (USA)), Malayalam, Middle Latin, machine language, maximum likelihood, mean level, mile, mold line, monolithic, malignant lymphoma13) Текстиль: Medium Large14) Университет: Multi Language15) Физиология: Malo Lactic, Maximum to left, Midline16) Электроника: Magnetic Latching, Mono Layer17) Вычислительная техника: Mail List, metalanguage, Maintenance Lead (JCP), машинный язык, метаязык18) Нефть: Minilog, contact log, mud logger, proximity-microlog, лаборатория технического обслуживания (maintenance laboratory), средний ресурс (mean life), средняя долговечность (mean life), средняя наработка (mean life), уровень технического обслуживания (maintenance level), установка для контроля состояния и свойств бурового раствора (mud logger), Microlog (Microresistivity Log)19) Онкология: Millilitre 0.001 Liter20) Транспорт: Magnetic Levitation21) Фирменный знак: Merrill Lynch22) СМИ: Music Life23) Деловая лексика: Management Live, погонный метр (meter linear)25) Глоссарий компании Сахалин Энерджи: Ministry of Labor and Social Development of the RF, mud line26) Сетевые технологии: Multi Level27) Программирование: Make And Link28) Полупроводники: monolayer29) Сахалин Р: Ministry of Labor30) Химическое оружие: Munition loading31) Расширение файла: ML language source code file32) Нефть и газ: manipulated variable low-limit setpoint, micro log, micro log tool, МЗ, МК, микрозонд, микрокаротаж, прибор микрокаротажа33) Каспий: main line34) Электротехника: magnetic latch (ing), mechanical lock (ing)35) Имена и фамилии: Maurice Levine36) Правительство: Marriage License37) Единицы измерений: Meter Length, Milliliter -
20 Ml
1) Компьютерная техника: Markup Language, Memory Lock, Meta Language2) Спорт: Major League3) Военный термин: Management Level, Map List, Marshall Law, maintenance laboratory, maintenance level, manual loader, material list, medium lorry, military law, military liaison, military payroll money list, minelayer, minelaying, missile launch, missile launcher, missile layout, mission life, mission load, mobile laboratory, mobile land, mobile launcher, money list, motor launch, munitions list, muzzle loader, muzzle loading4) Техника: Microwave Laboratory, manufacturing license, mean life, molded line5) Сельское хозяйство: moisture loss6) Математика: максимальное правдоподобие (maximum likelihood)7) Лингвистика: machine learning8) Финансы: отмывание нелегальных доходов (money laundering)9) Автомобильный термин: среднее положение - низкая скорость10) Оптика: mode locked11) Политика: Mali, Marxist Leninist12) Сокращение: (type abbreviation) Minelayer (Ocean; O), Magic LANTIRN Adaptation (A), Magic Lantern (Adaptation; A), Magic Lantern (Airborne mine detection system (USA)), Malayalam, Middle Latin, machine language, maximum likelihood, mean level, mile, mold line, monolithic, malignant lymphoma13) Текстиль: Medium Large14) Университет: Multi Language15) Физиология: Malo Lactic, Maximum to left, Midline16) Электроника: Magnetic Latching, Mono Layer17) Вычислительная техника: Mail List, metalanguage, Maintenance Lead (JCP), машинный язык, метаязык18) Нефть: Minilog, contact log, mud logger, proximity-microlog, лаборатория технического обслуживания (maintenance laboratory), средний ресурс (mean life), средняя долговечность (mean life), средняя наработка (mean life), уровень технического обслуживания (maintenance level), установка для контроля состояния и свойств бурового раствора (mud logger), Microlog (Microresistivity Log)19) Онкология: Millilitre 0.001 Liter20) Транспорт: Magnetic Levitation21) Фирменный знак: Merrill Lynch22) СМИ: Music Life23) Деловая лексика: Management Live, погонный метр (meter linear)25) Глоссарий компании Сахалин Энерджи: Ministry of Labor and Social Development of the RF, mud line26) Сетевые технологии: Multi Level27) Программирование: Make And Link28) Полупроводники: monolayer29) Сахалин Р: Ministry of Labor30) Химическое оружие: Munition loading31) Расширение файла: ML language source code file32) Нефть и газ: manipulated variable low-limit setpoint, micro log, micro log tool, МЗ, МК, микрозонд, микрокаротаж, прибор микрокаротажа33) Каспий: main line34) Электротехника: magnetic latch (ing), mechanical lock (ing)35) Имена и фамилии: Maurice Levine36) Правительство: Marriage License37) Единицы измерений: Meter Length, Milliliter
См. также в других словарях:
Level sensor — Level sensors are used to detect liquid level. The liquid to be measured can be inside a container or can be in its natural form (e.g. a river or a lake). The level measurement can be either continuous or point values. Continuous level sensors… … Wikipedia
Moisture analysis — covers a variety of methods for measuring moisture content in both high level and trace amounts in solids, liquids, or gases. Moisture in percentage amounts is monitored as a specification in commercial food production. There are many… … Wikipedia
Moisture Sensitivity Level — relates to the packaging and handling precautions for some semiconductors. The MSL is an electronic standard for the time period in which a moisture sensitive device can be exposed to ambient room conditions (approximately 30°C/60%RH).… … Wikipedia
Moisture Sensitive Level — Der Moisture Sensitivity Level (MSL, dt. »Feuchtigkeitsempfindlichkeitsschwellwert«) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen bei der Verpackung, Lagerung und Montage. Inhaltsverzeichnis 1 Hintergrund 2… … Deutsch Wikipedia
moisture — noun ADJECTIVE ▪ excess ▪ soil ▪ body ▪ surface … OF MOISTURE ▪ bead … Collocations dictionary
Moisture Sensitivity Level — Der Moisture Sensitivity Level (MSL, dt. »Feuchtigkeitsempfindlichkeitsschwellwert«) bezieht sich auf die Feuchteempfindlichkeit von Halbleiterbauelementen bei der Verpackung, Lagerung und Montage. Hintergrund Kunststoffumspritzte SMD Bauelemente … Deutsch Wikipedia
equilibrium moisture basis — n data calculated to the moisture level established as the equilibrium moisture. Numerical values as established by Test Method D1412 are used for the calculation. D3180 … Coke&Coal Terminology
Concrete moisture meters — Moisture meters have been used for decades to measure different types of moisture content in different materials and substances. Concrete meters have evolved from the successful wood moisture meter as flooring contractors tried to use their wood… … Wikipedia
Soil Moisture and Ocean Salinity satellite — Global soil moisture and ocean salinity measurements are needed to better understand Earth’s water cycle and climate. Currently, there is no thorough dataset on soil moisture or ocean salinity. Current satellites operated by NASA have provided… … Wikipedia
Concrete moisture meter — A concrete moisture meter is a type of moisture meter used by installers of flooring to measure the moisture levels of concrete. These meters have been used for decades to measure the moisture content in different materials and substances.… … Wikipedia
Lifted condensation level — The lifted condensation level or lifting condensation level (LCL), represents the height at which an air parcel being lifted dry adiabatically will become saturated because of adiabatic cooling (caused by expansion) and condense into cloud. It… … Wikipedia