-
101 сероголовый магелланов гусь
Русско-английский биологический словарь > сероголовый магелланов гусь
-
102 серогорлый корольковый певун
Русско-английский биологический словарь > серогорлый корольковый певун
-
103 серый дронго
-
104 бледный
pale, pallid; wan (от утомления); insipid, colourless перен.* * ** * *pale, pallid; wan; insipid, colourless перен.* * *ashybloodlesschalkydoughyetiolatedlightlividlunarlunarymealypalepale-facedpallidpalypastypasty-facedsicksuetywanwashywaterywaxenwhey-facedwishy-washywishywashy -
105 землистый
-
106 земляной
-
107 пепельный
-
108 землистый
-
109 земляной
-
110 пепельный
прил.ashy, ashen, ash-grey -
111 пепельный
прлashy; о цвете ash-grey, ash-colo(u)red -
112 бюльбюль, красноухий восточный
—1. LAT Hypsipetes flavala ( Blyth)2. RUS красноухий восточный бюльбюль m3. ENG (oriental) brown-eared bulbul, chestnut-backed [ashy] bulbul4. DEU Braunohrbülbül m5. FRA bulbul m aux ailes vertesDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > бюльбюль, красноухий восточный
-
113 бюльбюль, серолобый манишковый
—1. LAT Criniger flaveolus ( Gould)2. RUS серолобый манишковый бюльбюль m3. ENG ashy-fronted bearded bulbul, white-throated bulbul4. DEU Weißkehlbülbül m5. FRA bulbul m flavéoléDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > бюльбюль, серолобый манишковый
-
114 голубь, пепельный
—1. LAT Columba pulchricollis ( Blyth) [ Palumbus pulchricollis ( Blyth)]2. RUS пепельный голубь m3. ENG ashy wood pigeon4. DEU Himalaya-Taube f, Nepal-Taube f5. FRA pigeon m à col fauveDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > голубь, пепельный
-
115 гусь, сероголовый Магелланов
—1. LAT Chloephaga poliocephalus ( Sclater)2. RUS сероголовый Магелланов гусь m3. ENG ashy-headed goose4. DEU Graukopfgans f5. FRA ouette f à tête griseDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > гусь, сероголовый Магелланов
-
116 дрозд, серый земляной
—1. LAT Zoothera cinerea ( Bourns et Worcester)2. RUS серый земляной дрозд m3. ENG ashy (ground) thrush4. DEU Mindoro-Drossel f5. FRA —DICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > дрозд, серый земляной
-
117 дронго, серый
—1. LAT Dicrurus leucophaeus ( Vieillot)2. RUS серый дронго m3. ENG ashy drongo4. DEU Graudrongo m5. FRA drongo m cendréDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > дронго, серый
-
118 жаворонок, серошапочный воробьиный
—1. LAT Eremopteris grisea ( Scopoli)2. RUS серошапочный воробьиный жаворонок m3. ENG ashy-crowned finch-lark4. DEU Grauscheitellerche f5. FRA alouette-moineau f croiséeDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > жаворонок, серошапочный воробьиный
-
119 иглохвост, пепельнохвостый
—1. LAT Chaetura andrei ( Berlepsch et Hartert)2. RUS пепельнохвостый иглохвост m3. ENG ashy-tailed [Andre’s] swift4. DEU Buriti-Segler m5. FRA martinet m d’AndréDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > иглохвост, пепельнохвостый
-
120 качурка, пепельная
—1. LAT Oceanodroma homochroa ( Coues)2. RUS пепельная качурка f3. ENG ashy (storm-)petrel4. DEU Einfarb-Wellenläufer m, Aschgrauer Wellenläufer m5. FRA océanite m cendréDICTIONARY OF ANIMAL NAMES IN FIVE LANGUAGES — BIRDS > качурка, пепельная
См. также в других словарях:
Ashy — Ash y, a. 1. Pertaining to, or composed of, ashes; filled, or strewed with, ashes. [1913 Webster] 2. Ash colored; whitish gray; deadly pale. Shak. [1913 Webster] {Ashy pale}, pale as ashes. Shak. [1913 Webster] … The Collaborative International Dictionary of English
ashy — late 14c., from ASH (Cf. ash) (1) + Y (Cf. y) (2) … Etymology dictionary
ashy — ashen, livid, pallid, wan, *pale Analogous words: (see those at ASHEN) … New Dictionary of Synonyms
ashy — [ash′ē] adj. ashier, ashiest 1. of, like, or covered with ashes 2. of ash color; pale; pallid … English World dictionary
ashy — /ash ee/, adj., ashier, ashiest. 1. ash colored; pale; wan: an ashy complexion. 2. of or resembling ashes: an ashy residue. 3. sprinkled or covered with ashes. [1350 1400; ME asshy. See ASH1, Y1] * * * … Universalium
ashy — Ⅰ. ash [1] ► NOUN 1) the powder remaining after something has been burned. 2) (ashes) the remains of a human body after cremation. 3) (the Ashes) a cricket trophy awarded for winning a test match series between England and Australia. [ORIGIN:… … English terms dictionary
Ashy Storm Petrel — Conservation status Endangered (IUCN 3.1 … Wikipedia
Ashy Drongo — in Kolkata, West Bengal, India. Conservation status … Wikipedia
Ashy-tailed Swift — Conservation status Not recognized (IUCN 3.1) Scientific classification Kingdom: Animalia Phylum … Wikipedia
Ashy-headed Flying Fox — Conservation status Near Threatened (IUCN 3.1)[1] … Wikipedia
Ashy-headed Goose — Adult in Patagonia, South America Conservation status … Wikipedia